| Transcript | Ll_transcript_166752 |
|---|---|
| CDS coordinates | 466-858 (+) |
| Peptide sequence | MEELECYNHEYRKRLDEVGALGEIPDDLGIEVSSPGAERILKVPDDLGRFKGMPMRVCYAENVESNCPEEDGIFLLDSIDRDSEICIWKLADVKENRDPLKKGKPLNRKQKDWRLKLSFNMHRMVTLYLD* |
| ORF Type | complete |
| Blastp | Ribosome maturation factor RimP from Leptospira with 39.53% of identity |
|---|---|
| Blastx | Ribosome maturation factor RimP from Leptospira with 33.1% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (LA_0941) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019459462.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer