Transcript | Ll_transcript_166763 |
---|---|
CDS coordinates | 176-664 (+) |
Peptide sequence | MMREVFRRLGSVRRYAKQSLRIDGVKHTIAVASGKGGVGKSTTAVNLAVSLATKCKLKVGLLDADVYGPNIPIMMNINTKPSVNLDMKMIPVENYGIKCMSIGFLVEKDAPIVWRGPMVSNALEKMTRGVNWGNLDILVMDMPPGTGDVQIAMSQKLQLSGS* |
ORF Type | complete |
Blastp | Iron-sulfur protein NUBPL from Dictyostelium with 55.26% of identity |
---|---|
Blastx | Iron-sulfur protein NUBPL from Dictyostelium with 55.26% of identity |
Eggnog | ATP-binding protein(COG0489) |
Kegg | Link to kegg annotations (DDB_G0291193) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428626.1) |
Pfam | NUBPL iron-transfer P-loop NTPase (PF10609.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer