Protein coding transcript 231731

• Transcript: Ll_transcript_166591
• CDS coordinates: 147-1046 (+)
• Peptide sequence: MIPIAFVQSLANIEGIERAVPFLKPFIEIKFIKSLIQGFLPGIALKLFLIFLPSILMLMSKFEGFISLSALERRSASRYYIFQFINVFLGSIITGSAFEQLDKFSRLPANEIPKIVGVSIPMKATFFITYIMVDGWAGCAGEILRLKPLIFFHLKNFFLVKTEKDREEAMDPGTIGFNTGEPQIQLYFLLGLVYAVVTPFLLPYIIVFFGFAYVVYRHQIINVYNQEYESAAAFWPDVHGRIIFALVISQLLLMGLMSTKEAANSTPLLIALPVLTIWFHIFCKGRYEPAFIKHPLQEAM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_166591

• Blastp: CSC1-like protein At3g21620 from Arabidopsis with 81% of identity
• Blastx: CSC1-like protein At3g21620 from Arabidopsis with 81.32% of identity
• Eggnog: transmembrane protein 63C(COG5594)
• Kegg: Link to kegg annotations (AT3G21620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461627.1)
• Pfam: Calcium-dependent channel, 7TM region, putative phosphate (PF02714.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;