Transcript | Ll_transcript_166604 |
---|---|
CDS coordinates | 217-1170 (+) |
Peptide sequence | MASLGDIGLSAAINLLSAFVFLVAFAILRIQPINDRVYFPKWYMKGLRSSPLHSRAFVGKFVNLDFTSYVKFLNWMPAALQMPEPELIDHAGLDSAVYLRIYLLGLKIFVPIAFLAFSVMVPVNWTNNTLARSNLTYSSIDKLSISNIPLGSNRFWTHLVMAYAFTFWTCYILKREYEVVATMRLHFLASQRRRPDQFTVIVRNVPPDADESVSELVEHFFLVNHPDHYLTHQVVYNAKKLSSLVAKKKKMQNWLDYYQLKHSRNQSARPTKRVHRSGSFELKIVFHFEFGFSISFLLSLFKPFHFIIFLPLFYSSG* |
ORF Type | complete |
Blastp | CSC1-like protein At1g11960 from Arabidopsis with 74.36% of identity |
---|---|
Blastx | CSC1-like protein At3g21620 from Arabidopsis with 79.08% of identity |
Eggnog | transmembrane protein 63C(COG5594) |
Kegg | Link to kegg annotations (AT1G11960) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434074.1) |
Pfam | Late exocytosis, associated with Golgi transport (PF13967.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer