Transcript | Ll_transcript_166613 |
---|---|
CDS coordinates | 1813-3159 (+) |
Peptide sequence | MPAAFVSFRTRWGAAVCAQTQQTKNPTIWLTEWAPEPRDVYWDNMAIPYVSLTIRRLIIFVAFFFLTFFFMIPIAFVQSLANIEGIEKAAPFLKPFIEINFIKSLIQGFLPGIALKLFLIFLPTILMIMSRFEGFISLSGLERRAATRYYIFQFINVFLGSIITGSAFQQLDKFINQSANQIPKTVGVSIPMKATFFITYIMVDGWAGCAGEILRLKPLIFFHLKNFFLVKTDKDREEAMDPGTIGFNTGEPQIQLYFLLGLVYAVVTPFLLPYIIVFFGFAYVVYRHQIINVYNQEYESAAAFWPDVHGRIIYALVISQLLLMGLFSSKGVANSTPFLIVLPILTIWFHIFCKGRYEPAFIRHPLQEAMIKDTLERTKEPNFNLKEFLQNAYIHPVFKGDEDVDSDVMSEGWEQEPAVVQTKRQSRRNTPLPSKHSGSLSPSHSLNH* |
ORF Type | complete |
Blastp | Calcium permeable stress-gated cation channel 1 from Arabidopsis with 77.93% of identity |
---|---|
Blastx | Calcium permeable stress-gated cation channel 1 from Arabidopsis with 77.33% of identity |
Eggnog | transmembrane protein 63C(COG5594) |
Kegg | Link to kegg annotations (AT4G22120) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434074.1) |
Pfam | Cytosolic domain of 10TM putative phosphate transporter (PF14703.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer