Protein coding transcript 231741

• Transcript: Ll_transcript_166617
• CDS coordinates: 325-1248 (+)
• Peptide sequence: MPAAFVSFRTRWGAAVCAQTQQTKNPTIWLTEWAPEPRDVYWDNMAIPYVSLTIRRLIIFVAFFFLTFFFMIPIAFVQSLANIEGIEKAAPFLKPFIEINFIKSLIQGFLPGIALKLFLIFLPTILMIMSRFEGFISLSGLERRAATRYYIFQFINVFLGSIITGSAFQQLDKFINQSANQIPKTVGVSIPMKATFFITYIMVDGWAGCAGEILRLKPLIFFHLKNFFLVKTDKDREEAMDPGTIGFNTGEPQIQLYFLLGLVYAVVTPFLLPYIIVFFGFAYVVYRHQVKICSQNLFTVGTKLLYL*
• ORF Type: complete

Annotations of Ll_transcript_166617

• Blastp: CSC1-like protein At4g15430 from Arabidopsis with 81.72% of identity
• Blastx: CSC1-like protein At3g21620 from Arabidopsis with 79.08% of identity
• Eggnog: transmembrane protein 63C(COG5594)
• Kegg: Link to kegg annotations (AT4G15430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434074.1)
• Pfam: Cytosolic domain of 10TM putative phosphate transporter (PF14703.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;