Transcript | Ll_transcript_166598 |
---|---|
CDS coordinates | 688-2016 (+) |
Peptide sequence | MDFYTTEIEKLSKEIELERDKLMKDPKSIMPAAFVSFRSRWGAAVCAQTQQSRNPTIWLTEWAPEPRDVYWDNMAIPYVSLSIRRLIILVAFFFLTFFFMIPIAFVQSLANIEGIERAVPFLKPFIEIKFIKSLIQGFLPGIALKLFLIFLPSILMLMSKFEGFISLSALERRSASRYYIFQFINVFLGSIITGSAFEQLDKFSRLPANEIPKIVGVSIPMKATFFITYIMVDGWAGCAGEILRLKPLIFFHLKNFFLVKTEKDREEAMDPGTIGFNTGEPQIQLYFLLGLVYAVVTPFLLPYIIVFFGFAYVVYRHQIINVYNQEYESAAAFWPDVHGRIIYALVISQLLLMGLFSSKGVANSTPFLIVLPILTIWFHIFCKGRYEPAFIRHPLQEAMIKDTLERTKEPNFNLKEFLQNAYIHPVFKGDEDVDSDVMSEGWE |
ORF Type | 3prime_partial |
Blastp | CSC1-like protein At3g21620 from Arabidopsis with 75% of identity |
---|---|
Blastx | CSC1-like protein At3g21620 from Arabidopsis with 73.85% of identity |
Eggnog | transmembrane protein 63C(COG5594) |
Kegg | Link to kegg annotations (AT3G21620) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461627.1) |
Pfam | Cytosolic domain of 10TM putative phosphate transporter (PF14703.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer