Transcript | Ll_transcript_168441 |
---|---|
CDS coordinates | 359-1453 (+) |
Peptide sequence | MTMVKSYSSGVCVRGFGFSDHHSNVGDGNKRSSYWKPPQATLNFHLPMRSFEVKNRTSTDDIKCLRLITAIKTPYLPDGRFDIEAYDDLVNTQIENGVEGIIVGGTTGEGQLMSWDEHIMLIGHTVNCFGGNVKVIGNTGSNSTSEAIHASEQGFAVGMHAALHINPYYGKTSMDGLVSHFDSVLSMGPTIIYNVPSRTGQDIPPHVILTFAHNSNFAGIKECMGNDRIKQYTGNGIVAWSGNDDECHDARWGYGATGVISVTSNLIPGLMHKLMFDGKNSTLNSKVRPLVDWLFKEPNPIGLNTALAQLGVVRPVFRLPYVPLQIEKRIEFVNLVNEIGREHFVGEKEVKVLEEDDFILLGRY* |
ORF Type | complete |
Blastp | 4-hydroxy-tetrahydrodipicolinate synthase 2, chloroplastic from Arabidopsis with 78.34% of identity |
---|---|
Blastx | 4-hydroxy-tetrahydrodipicolinate synthase 2, chloroplastic from Arabidopsis with 78.34% of identity |
Eggnog | Catalyzes the condensation of (S)-aspartate-beta- semialdehyde (S)-ASA and pyruvate to 4-hydroxy- tetrahydrodipicolinate (HTPA) (By similarity)(COG0329) |
Kegg | Link to kegg annotations (AT2G45440) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443771.1) |
Pfam | Dihydrodipicolinate synthetase family (PF00701.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer