Protein coding transcript 231765

• Transcript: Ll_transcript_168444
• CDS coordinates: 307-1398 (+)
• Peptide sequence: MAMLKSYNSSACFRGFDFPVHRYNANKRRSYWKPPQAVVIPNFHLPMRSFEVKNRTSTDDIKCLRLITAIKTPYLPDGRFDLEAYDDLVNTQIEHGVEGIIVGGTTGEGQLMSWDEHIMLIGHTVNCFGGKIKVVGNTGSNSTSEAIHASEQGFGVGMHAALHINPYYGKTSMDGLVSHFDSVLSMGPTIIYNVPSRTGQDIPPHVILTFAHNSNFAGIKECMGNDRIKQYTGNGIVAWSGNDDECHDARWGYGATGVISVTSNLIPGLMHKLMFDGKNSTLNSKVRPLVDWLFKEPNPIGLNTALAQLGVVRPVFRLPYVPLQIEKRIEFVNLVNEIGREHFVGEKEVKVLEEDDFILLGRY*
• ORF Type: complete

Annotations of Ll_transcript_168444

• Blastp: 4-hydroxy-tetrahydrodipicolinate synthase 2, chloroplastic from Arabidopsis with 75.07% of identity
• Blastx: 4-hydroxy-tetrahydrodipicolinate synthase 2, chloroplastic from Arabidopsis with 75.07% of identity
• Eggnog: Catalyzes the condensation of (S)-aspartate-beta- semialdehyde (S)-ASA and pyruvate to 4-hydroxy- tetrahydrodipicolinate (HTPA) (By similarity)(COG0329)
• Kegg: Link to kegg annotations (AT2G45440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443771.1)
• Pfam: Dihydrodipicolinate synthetase family (PF00701.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;