| Transcript | Ll_transcript_169049 |
|---|---|
| CDS coordinates | 306-629 (+) |
| Peptide sequence | MKLHISPSLRHVSVLHGKGLKEFIKVQVASKRLSCRKLFYSILFFTFLLRFVFVFTSVDVIDGENKCSTIGTLSTSFFSHTHTNTYSVTNIITCRHGQKDTTLHHRI* |
| ORF Type | complete |
| Blastp | Probable galacturonosyltransferase 14 from Arabidopsis with 43.84% of identity |
|---|---|
| Blastx | Probable galacturonosyltransferase 12 from Arabidopsis with 64.86% of identity |
| Eggnog | Galacturonosyltransferase(ENOG410ZY1J) |
| Kegg | Link to kegg annotations (AT5G15470) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019437125.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer