Protein coding transcript 232032

• Transcript: Ll_transcript_184578
• CDS coordinates: 437-1255 (+)
• Peptide sequence: MMMFEDMGLCGDFDMLCGGSLGEGDIVAKQTEPDAVVEDEYSDEELDVDELERRMWRDKMRLKRLKEQSKPKEGIDAAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPAAISKYQADNAIPGKNDGCNSIGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPTGNEEWWPQIGLPKDQCPPPYKKPHDLKKSWKVGVLTAVIKHMSPDIAKNRKLVRQS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_184578

• Blastp: Protein ETHYLENE INSENSITIVE 3 from Arabidopsis with 84.25% of identity
• Blastx: Protein ETHYLENE INSENSITIVE 3 from Arabidopsis with 84.25% of identity
• Eggnog: protein ethylene insensitive(ENOG4110EBS)
• Kegg: Link to kegg annotations (AT3G20770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455873.1)
• Pfam: Ethylene insensitive 3 (PF04873.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;