| Transcript | Ll_transcript_284013 |
|---|---|
| CDS coordinates | 117-428 (+) |
| Peptide sequence | MASSESSLNVPFLLLPSLATSLFFILLQIIIQTNVSSVSSKQIQTQDLLILPLKVQTLPLPSSRKLTFHHNVTLTISLTVGTPPQNVTMVLDTGSELSWLHCKN |
| ORF Type | 3prime_partial |
| Blastp | Aspartic proteinase PCS1 from Arabidopsis with 64.91% of identity |
|---|---|
| Blastx | Aspartic proteinase PCS1 from Arabidopsis with 64.91% of identity |
| Eggnog | aspartic(ENOG410XNV7) |
| Kegg | Link to kegg annotations (AT5G02190) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019461846.1) |
| Pfam | Xylanase inhibitor N-terminal (PF14543.5) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer