Protein coding transcript 232138

• Transcript: Ll_transcript_186167
• CDS coordinates: 3-458 (-)
• Peptide sequence: MVPTILKMSGVPRNFWPEAVNWSIHLLDRSPTFVVKNVTPEEAWKGHKPSVEHFKIFGCIAYAHVPDQKRKKLDDKGEKCVFLGVSEASKAYKLYNPLTKRIVTSRDVIFDEERTWEWNGQHPNPNTSEFGFEEEEQENGGEEKIGTPTREE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_186167

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 41.44% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 35.46% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014623149.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;