Protein coding transcript 232146

• Transcript: Ll_transcript_186173
• CDS coordinates: 1125-1652 (-)
• Peptide sequence: IMNMVRSMLSEKEVPKVFWPEAANWSVHVLNRSPTMAVKDVTPEEEWSGVKPTVGYFRVFGYVAHVHIPDKKRIKLDDKSFQCVLLGVSEESKAYRLYDPASNCIVVSRDVVFEENLSWNWGRKIEEVKLDVLELGDEDEQNESDQGNEEENSEHDEEGQVTSSSSESLDQSPPN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_186173

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 40.52% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 35.59% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014511418.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;