Protein coding transcript 232225

• Transcript: Ll_transcript_184554
• CDS coordinates: 3-1694 (+)
• Peptide sequence: WFCQLSCRFNRSIISFQTSVAQSFQRHFTDMASEGGKSFARRDRLREIETKVQTWWEEKDIFRSEPGDKPPEPGEKFFGNFPFPYMNGYLHLGHAFSLSKLEFAAAYHRLRGANVLLPFAFHCTGMPIKASADKLAREIQKFGNPPVFPGESEEQPEEKNDDNSSNESAPGKFKGKKSKAAAKSGGQVYQWEIMRSVGISDSDIAKFQDPYEWLKFFPPLAVEDLKAFGLGCDWRRSFITTDLNPYFDSFVGWQMRKLKSLGKVVKDVRYTIFSPLDGQPCADHDRASGEGVLPQEYTIIKMELLKPFPEKFKVLEGKKVFLAAATLRPETMYGQTNAWVLPDGKYGAFEINETEVFVMAHRAALNLAYQNHSRVSEKPSCLLEVTGHDLIGLPLKSPLSLNEVIYALPMLSILMDKGTGVVTSVPSDAPDDYMALQDLKSKPAFRAKFGVKDEWVLPFEILPIIDVPPFGNKCAERVCLDMKIKSQNEKEKLAEAKRQTYLKGFNDGTMIVGEYAGRKVQEAKPLVRSKLLETGQQLLLHYFIILFILVYITIYIILIPLPA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_184554

• Blastp: Leucine--tRNA ligase, cytoplasmic from Arabidopsis with 72.99% of identity
• Blastx: Leucine--tRNA ligase, cytoplasmic from Arabidopsis with 72.54% of identity
• Eggnog: Leucyl-trna synthetase(COG0495)
• Kegg: Link to kegg annotations (AT1G09620)
• CantataDB: Link to cantataDB annotations (CNT0002196)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421671.1)
• Pfam: tRNA synthetases class I (I, L, M and V) (PF00133.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;