Protein coding transcript 232353

• Transcript: Ll_transcript_186248
• CDS coordinates: 413-913 (+)
• Peptide sequence: MNQMESVPSDASTSPPVKDTGGQASAAVGSGQDNSAHEAPSRVSPTGISSWAKNLKVSKSFSGSQDVSSSGNAGKSAFSRITSNIGLRLSPKSPPVAEDSSSETAGQSNLFGSITKGLVDTSKNAVKAVQVKARHVVSQNKRRYQVLFSFTLIYCVYICKAVDHEV*
• ORF Type: complete

Annotations of Ll_transcript_186248

• Blastp: Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A from Arabidopsis with 50% of identity
• Blastx: Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A from Arabidopsis with 89.19% of identity
• Eggnog: dual specificity phosphatase(COG2453)
• Kegg: Link to kegg annotations (AT3G19420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441471.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;