Protein coding transcript 232385

• Transcript: Ll_transcript_183721
• CDS coordinates: 846-1412 (+)
• Peptide sequence: MTIARGKKSGTLYKTPGACHLIAVATNENPNLWHQRLGHMSEKGMKFMHSKGKLPGLQSVEIDMCEDCIFGKQKRVSFQKSGRTLKKERLELVHSDAWGPTTVSSISEKQYFVTFIDDHYKKVWVYFLKHKSEVFEAFKMWKAIVENETGLKVKKLRTDNGGEYEDTRFKKFCYEHGIRMERTMSGTP*
• ORF Type: complete

Annotations of Ll_transcript_183721

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 46.6% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 42.07% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020963654.1)
• Pfam: GAG-pre-integrase domain (PF13976.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;