Protein coding transcript 232424

• Transcript: Ll_transcript_186067
• CDS coordinates: 364-1359 (+)
• Peptide sequence: MHQGDYTSAPYYQFPHLQNPNYPSDPISNPYASAPPFASDHAPYPHNSDPAPIPTVPSPTAPPSYPPQSHHPNSNFTPFNSSSLPTPFPSFESHIPYQPPQSQPLPHQHQQPQPYYPPYDQQHQTAPNYTPSPPNPLPPNLNNPLYSSSYSAPYTHPGSYETPFENAVKFDQGGGYLDDGYGNFNRSRSDFYGTQPQDEGYGDGVFPYEGGKVEPYGARGTAPKSSTWAAFDDYGRSISSPSAAKESSAMSKIVKAVPKVDAAEDVKSGVQKFRVRVLSESFGQTNMDVLCQIGLDGIRMLDPNTSRMLRIYPLENITRCEVSLLNFSVKY*
• ORF Type: complete

Annotations of Ll_transcript_186067

• Blastp: Protein FREE1 from Arabidopsis with 44.3% of identity
• Blastx: Protein FREE1 from Arabidopsis with 56.91% of identity
• Eggnog: FYVE zinc finger(ENOG410Y0W8)
• Kegg: Link to kegg annotations (AT1G20110)
• CantataDB: Link to cantataDB annotations (CNT0002115)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449470.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;