Transcript | Ll_transcript_186045 |
---|---|
CDS coordinates | 252-1304 (+) |
Peptide sequence | MHQADYTSSSYYQFPQNPIPNPSYPSDPLPNHHASAPPFASDFAPAPAPPSPTAPPSYPPPPSHPTTNFHPFRSQFPCQPQPPLPLPHQHQSYYPPYDHQNQTAPNYTQSLPANPNSNPLYSSAYSAPYTTPGSYETPFQNPVKFDQGGGYLDDGYGSFNGGRSDYGKQPQDEGYGEGVFAYEGGKVEPYGARGTGSKLSNLTAFDDYGRPISFPSSAKEPSVTSKIVKAVPRVDVDEDVKSGVQKFRVKVLAESVGQSNMDVLCQIGLDGIHMLDPNTSRTLRIYPIENITRCEKFDSSTLAFWSKSLVDMEPRRIRLQSNSYTTNTLLDIVTAATIQLNGCYHGRYTG* |
ORF Type | complete |
Blastp | Protein FREE1 from Arabidopsis with 58.48% of identity |
---|---|
Blastx | Protein FREE1 from Arabidopsis with 59.18% of identity |
Eggnog | FYVE zinc finger(ENOG410Y0W8) |
Kegg | Link to kegg annotations (AT1G20110) |
CantataDB | Link to cantataDB annotations (CNT0000362) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453258.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer