Transcript | Ll_transcript_183564 |
---|---|
CDS coordinates | 535-1110 (+) |
Peptide sequence | MSSGGCSIVWFRRDLRVEDNPALMAGVRAGSVVAVFIWAPEEEGQYQPGRVSRWWLKHSLAYLDSSLRNLGTPLITKRSTDSVSALLEVVKSTGATQLFFNHLYDPLSLIRDHRSKEVLTAHGITVRSFNSDLLYEPWDVNDDHGQPFTTFDAFWERCLNMPYDPQSPSLPPKRIIPGLLLFNSFLILVFF* |
ORF Type | complete |
Blastp | Cryptochrome-1 from Arabidopsis with 78.95% of identity |
---|---|
Blastx | Cryptochrome-1 from Arabidopsis with 78.95% of identity |
Eggnog | deoxyribo-dipyrimidine photolyase(COG0415) |
Kegg | Link to kegg annotations (AT4G08920) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461069.1) |
Pfam | DNA photolyase (PF00875.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer