Protein coding transcript 232494

• Transcript: Ll_transcript_185220
• CDS coordinates: 221-799 (+)
• Peptide sequence: MNGGGRQGQRSGAAAVHHQRQYSDNFLDGSSNARWLQSAGLQHLQSSSATLQDFNLQGGRTFRNQQRSFNGGSGNQYFMEPSTPPGNNNRLMQKSNGEDSPGDFSPGLLDLHSFDTELIPEMPVSNVYGGNLLYPPARTRSFEDSEPGMLSKQTGRARVPAPENMLKSFPSDKEKFSSVAKIKVVVCSLTFE*
• ORF Type: complete

Annotations of Ll_transcript_185220

• Blastp: Kinesin-like protein KIN-13B from Arabidopsis with 49.16% of identity
• Blastx: Kinesin-like protein KIN-13B from Arabidopsis with 87.23% of identity
• Eggnog: Kinesin family member(COG5059)
• Kegg: Link to kegg annotations (AT3G16060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458284.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;