Protein coding transcript 232519

• Transcript: Ll_transcript_183979
• CDS coordinates: 1340-1711 (+)
• Peptide sequence: MHFNFVFASSNSDCMILKLLGLVLKRFFCSIFYFKCSTFLLGKASHKDVKDSTNWLFKAYYGNRIFMAYCCVSCEVLYLIMFYLAEKQTDKLVDVLKINLQKISIHSFLIATSLFGWAIKQVIN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_183979

• Blastp: CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1 from Arabidopsis with 63.64% of identity
• Blastx: CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1 from Arabidopsis with 84.62% of identity
• Eggnog: cdp-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase(COG0558)
• Kegg: Link to kegg annotations (AT1G68000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412892.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;