Transcript | Ll_transcript_284021 |
---|---|
CDS coordinates | 93-428 (+) |
Peptide sequence | MDSKPWIILVLLAFSMLLASQASTIHEFGREMVTPGDIDLITDDNEFLMSSEIARRTLRGRRRYIGYNSMRANQVPCGQRGRSYYNCQQRGRANPYRRGCTKITNCARNVN* |
ORF Type | complete |
Blastp | Protein RALF-like 4 from Arabidopsis with 43.52% of identity |
---|---|
Blastx | Protein RALF-like 4 from Arabidopsis with 43.52% of identity |
Eggnog | hormone activity(ENOG410ZNB7) |
Kegg | Link to kegg annotations (AT1G28270) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440241.1) |
Pfam | Rapid ALkalinization Factor (RALF) (PF05498.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer