Protein coding transcript 23271

• Transcript: Ll_transcript_366208
• CDS coordinates: 142-444 (+)
• Peptide sequence: MYTNFIRLRTLRSRSCNRVPSRFASSSSIATKQPSPGLGGLLGWLTGDRSSLVPPLDFPLSNINLPPTLLDYVNLPLKLRRLLVPLLVYMLTVVQSMRLR*
• ORF Type: complete

Annotations of Ll_transcript_366208

• Blastp: Mitochondrial-processing peptidase subunit alpha from Solanum with 56.72% of identity
• Blastx: Mitochondrial-processing peptidase subunit alpha from Solanum with 82% of identity
• Eggnog: peptidase'(COG0612)
• Kegg: Link to kegg annotations (102580877)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446405.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;