Protein coding transcript 2328

• Transcript: Ll_transcript_284001
• CDS coordinates: 201-983 (+)
• Peptide sequence: MFNVTLTMSYHTLSYPSHMLLGSRNMCKLRSCHVQAMPPSSVILNAEESGNFYQSKKLHGSNLASGIKGEPVSPLISHGNGVGIIGGVSVDATLNFLRRIVELSSDSSKGGGESNSIPFVLCSDPLLNKEVLSYEKAHFVSGRSKVEFLKLDSSPIVQNLWNKRVFLENSGASCIVMPCNVSHSWYEEVSKGCSVPFLHMAECVAKELKEAKLKPLEAGSPSRIGVLATNATLASGFYQEKLQNEVIRLFLHFLWSSLLL*
• ORF Type: complete

Annotations of Ll_transcript_284001

• Blastp: Aspartate racemase from Pyrococcus with 28.57% of identity
• Blastx: Aspartate racemase from Pyrococcus with 33.33% of identity
• Eggnog: aspartate racemase(COG1794)
• Kegg: Link to kegg annotations (PH0670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436379.1)
• Pfam: Asp/Glu/Hydantoin racemase (PF01177.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;