Protein coding transcript 232849

• Transcript: Ll_transcript_184923
• CDS coordinates: 1474-2604 (+)
• Peptide sequence: MAFERILFRATRGNVFLRQVVVEDPVIDPVSGEKTEKNVFVVFYAAEKAKSKILKICDAFGANRYPFAEEVGKQTQMIKEVSGRISELKTTIDAGLLHRDNLLQTIGAQFEQWNLLVRNEKSIYHTLNMLSLDVTKKCLVAEGWSPVFATKQVQDALQRAAIDSNSQVSAIVQVLHTRELPPTYFRTNKVTSSFQGIIDSYGVAKYQEANPTVYTVVTFPFLFAVMFGDWGHGICLLLAALYFIIREKKLSSKKLDDITEMTFGGRYVIFLMALFSIYTGVIYNEFFSVPFNIFGPSAYKCRDLSCKDATTVGLIKARRTYPFGVDPVWRGSRSELPFLNSLKMKMSILIGVAQMNLGIVMSFFNAIFFKNSVNVW*
• ORF Type: complete

Annotations of Ll_transcript_184923

• Blastp: V-type proton ATPase subunit a3 from Arabidopsis with 77.66% of identity
• Blastx: V-type proton ATPase subunit a3 from Arabidopsis with 75.11% of identity
• Eggnog: ATPase 116 kDa subunit(COG1269)
• Kegg: Link to kegg annotations (AT4G39080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448472.1)
• Pfam: V-type ATPase 116kDa subunit family (PF01496.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;