Transcript | Ll_transcript_184917 |
---|---|
CDS coordinates | 118-465 (+) |
Peptide sequence | MARKLRFFKEQMLKADVLPVHSTTVVDVNIDDLEVKLAEIESELTEINANGEKLQRSYNELVEYKLVLQKAGEFFHTAQSHAIEQQRENESRQLSGDSIETHLLQDQVDFFPAYI* |
ORF Type | complete |
Blastp | V-type proton ATPase subunit a3 from Arabidopsis with 59.63% of identity |
---|---|
Blastx | V-type proton ATPase subunit a3 from Arabidopsis with 62.32% of identity |
Eggnog | ATPase 116 kDa subunit(COG1269) |
Kegg | Link to kegg annotations (AT4G39080) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448472.1) |
Pfam | V-type ATPase 116kDa subunit family (PF01496.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer