Protein coding transcript 232870

• Transcript: Ll_transcript_185071
• CDS coordinates: 1646-2185 (+)
• Peptide sequence: MDAKRTLREIKLLKHMDHENIIALRDVIPPPLRREFNDVYIVTELMDTDLHHIIRSNQNLSEEHCQYFLYQVLRGLKYIHSANIIHRDLKPSNLLLNANCDLKIIDFGLARPALESDFMTEYVVTRWYRAPELLLNSSDYTSAIDVWSVGCIFMELMNKKPLLPGKDHVHQMRLMTEVR*
• ORF Type: complete

Annotations of Ll_transcript_185071

• Blastp: Mitogen-activated protein kinase 3 from Arabidopsis with 89.33% of identity
• Blastx: Mitogen-activated protein kinase 3 from Arabidopsis with 88.56% of identity
• Eggnog: Mitogen-activated protein kinase(ENOG410XNY0)
• Kegg: Link to kegg annotations (AT3G45640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412766.1)
• Pfam: Lipopolysaccharide kinase (Kdo/WaaP) family (PF06293.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;