Protein coding transcript 232968

• Transcript: Ll_transcript_185878
• CDS coordinates: 208-816 (+)
• Peptide sequence: MSISIRDLDPAFKGAGQKAGLEIWRIENFNPVPIPQSSYGKFFTGDSYVILKTTGTKSGALLHDIHYWLGKDTSQDEAGVAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIPQEGGVASGFKHAEAEEHKTRLFVCRGTHVVHVKEVTFARSSLNHDDIFVLDTESKIFQFNGSNSSIQERAKALEVVQYIKDTY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_185878

• Blastp: Villin-4 from Arabidopsis with 88.18% of identity
• Blastx: Villin-4 from Arabidopsis with 88.18% of identity
• Eggnog: capping protein (actin filament) gelsolin-like(ENOG410XR0A)
• Kegg: Link to kegg annotations (AT4G30160)
• CantataDB: Link to cantataDB annotations (CNT0002809)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442412.1)
• Pfam: Gelsolin repeat (PF00626.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;