Transcript | Ll_transcript_185880 |
---|---|
CDS coordinates | 2-625 (+) |
Peptide sequence | AFLFKIYHFSSSHESSVVAASFGYVLCLVLFRACTLSNASALFSLTIYRGLEIWRIENFNPVPIPQSSYGKFFTGDSYVILKTTGTKSGALLHDIHYWLGKDTSQDEAGVAAIKTVELDAALGGRAVQYREVQGHETEKFLSYFKPCIIPQEGGAASGFKHVEAEEHTTRLFVCRGKHVVNVKEVPFARSSLSHDDIFILDTDSEIIL |
ORF Type | internal |
Blastp | Villin-4 from Arabidopsis with 86.62% of identity |
---|---|
Blastx | Villin-4 from Arabidopsis with 86.62% of identity |
Eggnog | capping protein (actin filament) gelsolin-like(ENOG410XR0A) |
Kegg | Link to kegg annotations (AT4G30160) |
CantataDB | Link to cantataDB annotations (CNT0002809) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442412.1) |
Pfam | Gelsolin repeat (PF00626.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer