Protein coding transcript 232982

• Transcript: Ll_transcript_184610
• CDS coordinates: 200-958 (+)
• Peptide sequence: MSSSQSSSSPLKDEVDIVIPTTTNLDFLESWRPFFQPYHLIIIQHGDPSTTIHIPHGFDYQLYNRNDINRILGPKATCISFNYSASRSFAFMVSKKKYVFTIHHDCFVAKDPSGKEINALQQHIENLLTPSTPFFYNTLYDPYREGADFVRGYPFSLREGVPTAVSHGLWLDIPDYDAPTQLVKPLERNTRYVDAVMTIPKGALFPMCGMNLAFNRELIGPAMYFGLLGDDQPIGRYEDIWAGWCVKVFYIF*
• ORF Type: complete

Annotations of Ll_transcript_184610

• Blastp: UDP-arabinopyranose mutase 1 from Oryza sativa with 80.97% of identity
• Blastx: UDP-arabinopyranose mutase 1 from Arabidopsis with 84.03% of identity
• Eggnog: reversibly glycosylated polypeptide(ENOG411144T)
• Kegg: Link to kegg annotations (4333393)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451812.1)
• Pfam: Reversibly glycosylated polypeptide (PF03214.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;