Protein coding transcript 232990

• Transcript: Ll_transcript_184619
• CDS coordinates: 2166-2600 (+)
• Peptide sequence: MCGMNLAFDRELIGPAMYFGLMGDGQPIGRYDDMWAGWCIKVISDHLGLGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEEIIPFFQKATLSKNATTVQKSYIELSDQVREKLGPIDPYFVKLADAMVTWIEAWDELNTPSEA*
• ORF Type: complete

Annotations of Ll_transcript_184619

• Blastp: Alpha-1,4-glucan-protein synthase [UDP-forming] from Pisum with 89.29% of identity
• Blastx: Alpha-1,4-glucan-protein synthase [UDP-forming] 2 from Solanum with 90.12% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435050.1)
• Pfam: Reversibly glycosylated polypeptide (PF03214.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;