Protein coding transcript 23308

• Transcript: Ll_transcript_365214
• CDS coordinates: 3-383 (+)
• Peptide sequence: EQIEERMARIKEDPSLKHILEEIETGGPSAMMRYWNDEEVLGKLGQAMGLANTGDAAASSENSVPDETDDVGNEDESNVHHTASTGDVEGLKSALASGSDKDEEDSEGRTALHFSCGYGEVKCAQVL
• ORF Type: internal

Annotations of Ll_transcript_365214

• Blastp: Ankyrin repeat domain-containing protein 2A from Arabidopsis with 64.18% of identity
• Blastx: Ankyrin repeat domain-containing protein 2A from Arabidopsis with 64.18% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (AT4G35450)
• CantataDB: Link to cantataDB annotations (CNT0000133)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440909.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;