Protein coding transcript 233165

• Transcript: Ll_transcript_185169
• CDS coordinates: 1-465 (+)
• Peptide sequence: PSFSSLLLLSLVLATVAFVSSIEEFDLDLERRVHTQREFDYFTLGLQWPGTFCQRTQYCCSSNACCRGSNAPTTFTIHGLWPDYNDGTWPACCTKSSFNPKEISTLTDALEQYWPSLSCSKPSSCHGGKGSFWGHEVVIKNHLASYLSLSHYGF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_185169

• Blastp: Ribonuclease 2 from Arabidopsis with 63.43% of identity
• Blastx: Ribonuclease 2 from Arabidopsis with 71.43% of identity
• Eggnog: ribonuclease T2 activity(ENOG4111M7G)
• Kegg: Link to kegg annotations (AT2G39780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460218.1)
• Pfam: Ribonuclease T2 family (PF00445.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;