Protein coding transcript 233211

• Transcript: Ll_transcript_185810
• CDS coordinates: 480-1130 (+)
• Peptide sequence: MVNSEDFGEEYVVKQQPLSAIAEVFEELAKWLKERRMEEKELPLDTFCHACSFISVLFNSLGLAFKFAELEYVAKLHTLVEASKTCDTLLDILDLDVATDTVKTSGSYSRNLRRVRQGLGLIKAIFEQFLASEDTSLKDVASTAYAQSCAPYHTWAVRTAVYAGMYTLPTRYQLLAKLNETDQSAQKKMKRYIDASLPVIEYIDELYLSRNIVLDW*
• ORF Type: complete

Annotations of Ll_transcript_185810

• Blastp: ACD11 homolog protein from Arabidopsis with 68.47% of identity
• Blastx: ACD11 homolog protein from Arabidopsis with 68.47% of identity
• Eggnog: glycolipid transfer protein domain containing(ENOG4111NKT)
• Kegg: Link to kegg annotations (AT4G39670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427643.1)
• Pfam: Glycolipid transfer protein (GLTP) (PF08718.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;