Protein coding transcript 233309

• Transcript: Ll_transcript_184481
• CDS coordinates: 62-487 (+)
• Peptide sequence: MDDCLRRLINRIDSDESLKNLTPSDCISKLIRIRLEMQSPYISKWPQALSIQAQPINVPTSFKQRAMLVDEIWHAADDNTSNIDWYAKRTVLGGIYSTTEIYMLTDSSPDFRNTWAFLDARVKDAFDLKKTIQEVLLNLSM*
• ORF Type: complete

Annotations of Ll_transcript_184481

• Blastp: Ubiquinone biosynthesis protein COQ9, mitochondrial from Silurana with 39.13% of identity
• Blastx: Ubiquinone biosynthesis protein COQ9, mitochondrial from Silurana with 39.13% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (496601)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443403.1)
• Pfam: COQ9 (PF08511.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;