Protein coding transcript 233314

• Transcript: Ll_transcript_186030
• CDS coordinates: 129-434 (+)
• Peptide sequence: MHGRPRKPLKQEDTSALSAKTQNLRSLQSLFLTNHHNRIYTKEALDLNAKLVENNPEWHTAWNYRKLAVKNFLSPSESDPDYVKSILDEELRVVTFLLGFS*
• ORF Type: complete

Annotations of Ll_transcript_186030

• Blastp: Geranylgeranyl transferase type-2 subunit alpha 1 from Arabidopsis with 61.7% of identity
• Blastx: Geranylgeranyl transferase type-2 subunit alpha 1 from Arabidopsis with 61.7% of identity
• Eggnog: (alpha) subunit(COG5536)
• Kegg: Link to kegg annotations (AT4G24490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456127.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;