Protein coding transcript 233318

• Transcript: Ll_transcript_186019
• CDS coordinates: 52-528 (+)
• Peptide sequence: MPISFPHLPKISSIFFFSLPSPSLSLLQNPSFWIRVTAPFLPQIPLTKTRRYNNFINQSQKASCTSISIPHQSSQSHVTSLYSLLIIIIITITIISISISSYTKEALDLNAKLVENNPEWHTAWKYRKLVVESFLSRLESDPDYVKSILDEELRVSMH*
• ORF Type: complete

Annotations of Ll_transcript_186019

• Blastp: Geranylgeranyl transferase type-2 subunit alpha 1 from Arabidopsis with 62.96% of identity
• Blastx: Geranylgeranyl transferase type-2 subunit alpha 1 from Arabidopsis with 65.15% of identity
• Eggnog: (alpha) subunit(COG5536)
• Kegg: Link to kegg annotations (AT4G24490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431368.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;