Transcript | Ll_transcript_186019 |
---|---|
CDS coordinates | 52-528 (+) |
Peptide sequence | MPISFPHLPKISSIFFFSLPSPSLSLLQNPSFWIRVTAPFLPQIPLTKTRRYNNFINQSQKASCTSISIPHQSSQSHVTSLYSLLIIIIITITIISISISSYTKEALDLNAKLVENNPEWHTAWKYRKLVVESFLSRLESDPDYVKSILDEELRVSMH* |
ORF Type | complete |
Blastp | Geranylgeranyl transferase type-2 subunit alpha 1 from Arabidopsis with 62.96% of identity |
---|---|
Blastx | Geranylgeranyl transferase type-2 subunit alpha 1 from Arabidopsis with 65.15% of identity |
Eggnog | (alpha) subunit(COG5536) |
Kegg | Link to kegg annotations (AT4G24490) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431368.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer