| Transcript | Ll_transcript_185436 |
|---|---|
| CDS coordinates | 1-321 (+) |
| Peptide sequence | VAPAAMFGHHGQYFSQRGPLQSSNTPSIRAWIEPNSFAVAATVAAVSHPHYHHHYLSPAIHQASASGFASPYGGFSGFRIPARIQGEEEHDGVSDKPSSASSDSRH* |
| ORF Type | 5prime_partial |
| Blastp | Transcription factor TCP3 from Arabidopsis with 52.04% of identity |
|---|---|
| Blastx | Transcription factor TCP3 from Arabidopsis with 52.04% of identity |
| Eggnog | Transcription factor(ENOG410YG88) |
| Kegg | Link to kegg annotations (AT1G53230) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019413376.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer