Protein coding transcript 233431

• Transcript: Ll_transcript_185922
• CDS coordinates: 307-960 (+)
• Peptide sequence: MKQSLDPSSLGTSMFRSINMPKEAGPAAWGVLSGSDSYYASSDASLFSSSLPVLPHEKLNLSDMKNSYQSSGFKKLHQDIPGNDSPEDVDTNAIGSMLPDDEEELLAGIMDDFDLSGLPGSLEDLEEYDLFGSGGGMELETDPQESLSVGMSKLSFSDSTTGNGLPLNSFPNGVGAVAGEHPLGEHPSRTLFVRNINSNVEDSELKALFEVRLSLVI*
• ORF Type: complete

Annotations of Ll_transcript_185922

• Blastp: Protein MEI2-like 3 from Arabidopsis with 60.43% of identity
• Blastx: Protein MEI2-like 3 from Arabidopsis with 69.35% of identity
• Eggnog: Rna-binding protein(ENOG4111R9F)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415284.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;