Protein coding transcript 233479

• Transcript: Ll_transcript_184753
• CDS coordinates: 170-901 (+)
• Peptide sequence: MEEEKRSAIVKVEPKPRKGFIAIVIDLLEKLLVKLFHNSKRPHHYLAGNFAPVPDETPPTNDLPVLGYLPDCLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKAAYVSRFVRTSRLKQEESFRGAKYMKIGDLKGLFGLVVVNLQLLRSKFKVLDDSYGNSTANTALVYHHGKLLALSEVDKPYVIKVIEDGDLETLGLLDYDKRLSHSFTAHPKVDPVTGEVIYKYVIKFTDYIE*
• ORF Type: complete

Annotations of Ll_transcript_184753

• Blastp: Carotenoid 9,10(9',10')-cleavage dioxygenase 1 from Pisum with 74.78% of identity
• Blastx: Carotenoid 9,10(9',10')-cleavage dioxygenase 1 from Pisum with 72.93% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453435.1)
• Pfam: Retinal pigment epithelial membrane protein (PF03055.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;