Protein coding transcript 233494

• Transcript: Ll_transcript_184776
• CDS coordinates: 2172-2879 (+)
• Peptide sequence: MAILQSTMDKISSKKLTTLIILFFIAFPLALTANLMFRTSTFALFELFSQNKVAMKNASLPTSTNDPTSSSIRDKKTKPIGGLLASGFDESSCISRLQSHLYRKPSPHKPSPYLIYKLRNYEELHTRCGPNTRDYRRSMIKIVNSENNGNAAMCKYLVCVPVNGLGNQMISIAATFLYAVLTDRVLLVRFGEDKYRLFCEPFLNSTWILPKSFPFWNYKLVETYESMLKKEKGKNS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_184776

• Blastp: Fucosyltransferase 2 from Arabidopsis with 45.89% of identity
• Blastx: Carotenoid 9,10(9',10')-cleavage dioxygenase 1 from Pisum with 78.87% of identity
• Eggnog: fucosyltransferase(ENOG410XXHE)
• Kegg: Link to kegg annotations (AT2G03210)
• CantataDB: Link to cantataDB annotations (CNT0000976)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424997.1)
• Pfam: Xyloglucan fucosyltransferase (PF03254.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;