Protein coding transcript 233512

• Transcript: Ll_transcript_184757
• CDS coordinates: 605-1360 (+)
• Peptide sequence: MVTKNKLVYSFDSTKKARFGILPRYAKDEKHIRWFELPTCFIFHNANAWEEEDEVVLIACRIEKPDLDLVSGSLKEKLESFANELYEMRFNMKTGEASQKKLSAPALDFPRVNENYTGRKQRYVYGTILGSIARVTGIVKFDLHAQPEPENTKLVVGGNVQGIYDLGPGRFGSEAIYVPRVPGTTSEEDDGYLIFFVHDENTKKSYVHVVDAKTMSADPVAVVELPHRVPYGFHAFFVTEVFVISICFFMH*
• ORF Type: complete

Annotations of Ll_transcript_184757

• Blastp: Carotenoid 9,10(9',10')-cleavage dioxygenase 1 from Pisum with 81.67% of identity
• Blastx: Carotenoid 9,10(9',10')-cleavage dioxygenase 1 from Pisum with 80.99% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000976)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426193.1)
• Pfam: Retinal pigment epithelial membrane protein (PF03055.14)
• Rfam: 5S_rRNA (RF00001)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;