Transcript | Ll_transcript_184760 |
---|---|
CDS coordinates | 2522-3067 (+) |
Peptide sequence | MVNGAVKEKLENFSNELYEMRFNIKTGEASQKKLSASAVDFPRVNESYTGRKQRYVYGTTLDNIAKVTGIIKFDLHAKPDSGKTKLEVGGNVQGLYDLGPGRFGSEAVYVPRVPGTNSEEDDGYLIFFVHDENSRKSFVHVVDARTMSANPIAVVELPHRVPYGFHAFFVTEEQLQEQANL* |
ORF Type | complete |
Blastp | Carotenoid 9,10(9',10')-cleavage dioxygenase 1 from Pisum with 89.5% of identity |
---|---|
Blastx | Carotenoid 9,10(9',10')-cleavage dioxygenase 1 from Phaseolus with 85.02% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449591.1) |
Pfam | Retinal pigment epithelial membrane protein (PF03055.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer