Protein coding transcript 233517

• Transcript: Ll_transcript_183842
• CDS coordinates: 528-1019 (+)
• Peptide sequence: MKNILKKLHIMSNQSEDTAPQGSTTSSRGNKFNDGSSTPKKISNWLHSVSNRQSPSPPSPQRVELFDSVSSGGLDIVSDPARRDSGSSTSRDPEMEEEYQIQLALELSAKEDPEAVQIEAVKQISLGSCDPDNTPAEVVAYRYWVSHFTHFKPIYLRLKSNTC*
• ORF Type: complete

Annotations of Ll_transcript_183842

• Blastp: Probable serine/threonine-protein kinase SIS8 from Arabidopsis with 47.85% of identity
• Blastx: Probable serine/threonine-protein kinase SIS8 from Arabidopsis with 44.51% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G73660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421837.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;