Protein coding transcript 233520

• Transcript: Ll_transcript_183866
• CDS coordinates: 580-1095 (+)
• Peptide sequence: MKNILKKLHIMSNQSEDAAAQGSTTSSRGNKSNDGSSTPKKISNWLHSVSNRQSQSPPSPDLAIGERGELFDSVSSGVGVGLDIVSDSARHDSGSSSSRDPEVEEEYQIQLALEMSAKEDPEAVQIEAVKQISLGSCDPDNTPAEVVAYRYWVSHFTHFKPIYLRLKSNTC*
• ORF Type: complete

Annotations of Ll_transcript_183866

• Blastp: Probable serine/threonine-protein kinase SIS8 from Arabidopsis with 48.5% of identity
• Blastx: Probable serine/threonine-protein kinase SIS8 from Arabidopsis with 46.43% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G73660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446150.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;