Transcript | Ll_transcript_130784 |
---|---|
CDS coordinates | 166-714 (+) |
Peptide sequence | MWGVTPSNRWDWSALREMISRNGVRNSLLVAPMPTASTSQILGNNECFEPYTSNIYSRRVLSGEFVVVNKHLLNDLTEMGLWSPAIKNKIVYGNGSVQKIPEIPDELKTIYKTVWEIKQKTLVDMSVDRGCYIDQSQSLNIHMEQPNFGKLTSLHFYAWSKGLKTGMYYLRTQAAANAIQFTV |
ORF Type | 3prime_partial |
Blastp | Ribonucleoside-diphosphate reductase large subunit from Arabidopsis with 79.78% of identity |
---|---|
Blastx | Ribonucleoside-diphosphate reductase large subunit from Arabidopsis with 79.69% of identity |
Eggnog | Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides (By similarity)(COG0209) |
Kegg | Link to kegg annotations (AT2G21790) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430219.1) |
Pfam | Ribonucleotide reductase, barrel domain (PF02867.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer