Protein coding transcript 233646

• Transcript: Ll_transcript_130857
• CDS coordinates: 652-1359 (+)
• Peptide sequence: MINSAIKPQPIASKSSATPVSALPSIGCIVGSTDLRNSSKSPVTPAQLTIFYGGSVCVYDDVSPEKAQAIMLLAGNGTKPIQNMTHSTPKLQSEITTPSNDDCIIIGQSFPSLLTSPLLLASRAASRPCVGSSSSNELTILRPTGPLTTPSNHLHSPKIVGSVGSAATKMVQQVGGLPQARKASLARFLEKRKERVIITSPYYMNKKSPECSNQGSSGFSFSITSSDSCPLPAIN*
• ORF Type: complete

Annotations of Ll_transcript_130857

• Blastp: Protein TIFY 6B from Arabidopsis with 45.77% of identity
• Blastx: Protein TIFY 6B from Arabidopsis with 38.17% of identity
• Eggnog: TIFY 6B-like(ENOG410XTRE)
• Kegg: Link to kegg annotations (AT3G17860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457934.1)
• Pfam: tify domain (PF06200.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;