Protein coding transcript 2337

• Transcript: Ll_transcript_329307
• CDS coordinates: 159-1139 (+)
• Peptide sequence: MTISILKCTLTQPLINAPPHNGQKLSMRQIQKEKVVLVMGATGTGKSRLSIDLATCFPSEIINCDKMQVYEGLDIVTNKISKEQQRGVPHHLLGTHKPNTEFTATDFCEMSLASIGSITSRKRLPIIVGGSNSYLEALIDDDDYRFRSRYDLCCLWMDVSLPTLHSYVALRVDQMFEHGMVDEVRPFFNPNGGYSRGVRKAIGVPEFDEFFRREAFLDEETKQRLLEEAMNEMKVNTCNLAMKQFGRIRRLRNVKRWKIHRLDATTVFRKNGQEANEAWKKLVAEPSAMIVANFLYNSNTTSTTTTNGFSGLRMLPSHSVIAAATC*
• ORF Type: complete

Annotations of Ll_transcript_329307

• Blastp: Adenylate isopentenyltransferase 3, chloroplastic from Arabidopsis with 57.99% of identity
• Blastx: Adenylate isopentenyltransferase 3, chloroplastic from Arabidopsis with 53.59% of identity
• Eggnog: Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A) (By similarity)(COG0324)
• Kegg: Link to kegg annotations (AT3G63110)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452672.1)
• Pfam: Isopentenyl transferase (PF01745.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;