Transcript | Ll_transcript_133261 |
---|---|
CDS coordinates | 124-591 (+) |
Peptide sequence | MLLQKKINKFLDLKKAGRSFNGEVRNRKNYRNPDFLLHAVSYQDIDQIGSCFSKDVFDPHGCDPSDFYDEIEADLRRGSDRKEQEKKKEQKVEYIPGGTQPGIVAGALRISLPVAGGSAVAASGLHLVAPTTDSINRDGRQNKKSKWDNVDDDGKN |
ORF Type | 3prime_partial |
Blastp | SAP30-binding protein from Mus with 31.91% of identity |
---|---|
Blastx | SAP30-binding protein from Mus with 31.91% of identity |
Eggnog | SAP30 binding protein(ENOG4111K05) |
Kegg | Link to kegg annotations (57230) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439622.1) |
Pfam | HCNGP-like protein (PF07818.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer